BAY 55-9837
| SMILES | None |
| InChIKey | XALJYDFLMDKOLY-ZBLLYJRDSA-N |
| Sequence | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY |
Chemical properties
| Hydrogen bond acceptors | None |
| Hydrogen bond donors | None |
| Rotatable bonds | None |
| Molecular weight (Da) |
Drug properties
| Molecular type | Peptide |
| Physiological/Surrogate | Surrogate |
| Approved drug | No |
Database connections
Bioactivities
| Receptor | Activity | Source | |||||||
|---|---|---|---|---|---|---|---|---|---|
| GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
| VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pKd | 9.2 | 9.2 | 9.2 | Guide to Pharmacology |
| Receptor | Activity | Source | |||||||
|---|---|---|---|---|---|---|---|---|---|
| GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
| PAC1 | PACR | Human | VIP and PACAP | B1 | pIC50 | 5.0 | 5.0 | 5.0 | Guide to Pharmacology |
| VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pIC50 | 5.1 | 5.1 | 5.1 | Guide to Pharmacology |
| VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pEC50 | 7.0 | 7.0 | 7.0 | Guide to Pharmacology |
| VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pIC50 | 7.2 | 7.2 | 7.2 | Guide to Pharmacology |
| VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pEC50 | 9.4 | 9.4 | 9.4 | Guide to Pharmacology |